SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02873 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02873
Domain Number 1 Region: 107-178
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.88e-26
Family Skp1 dimerisation domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 28-94
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000392
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02873
Sequence length 208
Comment (Caenorhabditis remanei)
Sequence
MSAEQAPVEVPAVDAPVAEAAPAEPTVYYTLESCDGDEVKISSEAVKQSKTLNDLVSNLH
GGAEMNESIPMDNIKKPALVKVVEFCEHHKGEPIPVDDDTVPKNVTIPEWDEEFLKIDND
ELFHLILAANYLDIKQLMNYACKKVALMAKGKSPEELRVIFEIPTDEEDEAAEKAAAEKK
KAKEAEKAAAAGEAGPSAAGAEDVAAAN
Download sequence
Identical sequences E3LWD4
XP_003111545.1.11157 CRE02873 31234.CRE02873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]