SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03075
Domain Number 1 Region: 35-131
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000719
Family MATH domain 0.0079
Further Details:      
 
Weak hits

Sequence:  31234.CRE03075
Domain Number - Region: 224-295
Classification Level Classification E-value
Superfamily Hemerythrin-like 0.00314
Family Hemerythrin-like 0.012
Further Details:      
 
Domain Number - Region: 165-246
Classification Level Classification E-value
Superfamily POZ domain 0.00604
Family BTB/POZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03075
Sequence length 308
Comment (Caenorhabditis remanei)
Sequence
MSERYSKNGVHTFENVVGHLAQGGVQMHRLGLIGFHEWFLGLGVDDKSYFRLFLTRNNEN
SIVEIGIRYYLEIKNSNEILQEKYKTEGFVFLKHREVANNKYIPLLEVLNLNNGWLIDEK
CTVEYGIQVESILETDGIWKFNFCEELFDCKQKQDMIRFCQKNTDRYLHSHKQILIHNCP
HYSGSTTESHDKLIPDDVELSDLEQCFQIANGVRIDLSTYRLLGLPEVAQSLLLTNASHF
IEEQLIWKQYKNEKFILHAIEHDLSRFLAVLLKSATPEYVLEIIRGHIDILSMEIKKMIV
AKVLYGRY
Download sequence
Identical sequences E3LWF1
CRE03075 31234.CRE03075 XP_003111573.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]