SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03093
Domain Number 1 Region: 107-174
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-21
Family Skp1 dimerisation domain-like 0.00038
Further Details:      
 
Domain Number 2 Region: 28-93
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000173
Family BTB/POZ domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03093
Sequence length 249
Comment (Caenorhabditis remanei)
Sequence
MSAEQAPADVHAVDAPVAEAAPAEPTVYITLESHHGMEVKISSLALKQSKTLADLVSNLH
GGEDPHEAIPVADVTKDTLVKIVQWCEKHAGEPRLPDDFVADHEFVIPEWDQEFLDIDND
VLFELMLASNYLNIKKLSIYGMKKVALMAKGKSPEELRELYAIPTDEQDEVAEARARARA
AARAAARAGDGTGDGTGAEAAGAGSGAGAAVADVGAGAGAEEAVAEAGGEDAVADEGAAP
EDDAAQPSD
Download sequence
Identical sequences E3LWI2
XP_003111648.1.11157 31234.CRE03093 CRE03093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]