SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03094 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03094
Domain Number 1 Region: 117-182
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.84e-23
Family Skp1 dimerisation domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 42-108
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000746
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03094
Sequence length 244
Comment (Caenorhabditis remanei)
Sequence
MSAEQAPVEVPAADAPVAEAEPAPVAEEAPAAETAPAEPLFYYTLESCDGKEVKISSEAV
KQSKTLNDLVWNLHGGAEMDESIPMDNITHPTLIKVVEFCEHHKGEPIPVDDGSVPKKVT
ITEWDEEFFKMDDMELFHLVLAANYLDIKQLMNYACKKVAQMAMGKSPEELRAIFMIPTD
EEIEAAEKAAEKEEVARQVAYNLAEINRKIKEMEQADAAAAASRAKEAAAAGAEELIAGV
KEAS
Download sequence
Identical sequences E3LWI3
31234.CRE03094 XP_003111660.1.11157 CRE03094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]