SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03095 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03095
Domain Number 1 Region: 96-167
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 6.67e-20
Family Skp1 dimerisation domain-like 0.00067
Further Details:      
 
Domain Number 2 Region: 16-81
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000228
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03095
Sequence length 201
Comment (Caenorhabditis remanei)
Sequence
MSTGEAPEAAADPDVYFTLQSSDGQELKISSLASQQSKTLKNLLASLHDGADFNEVISMD
NIKEATLLKIIEWCEHNRGEPVPDHDEDPKPGSVRFSEWDKEYLEIDCSQLFDLIVAADY
LNIRKLLVYATNKVALMGKGKSPEQMRVTYMIPTDEEDEAAEKAAAEKKKAKEAERAAAA
AAGETGPSASGAEAAAEAKDA
Download sequence
Identical sequences E3LWI4
CRE03095 31234.CRE03095 XP_003111803.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]