SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03098 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03098
Domain Number 1 Region: 107-178
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.75e-26
Family Skp1 dimerisation domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 28-94
Classification Level Classification E-value
Superfamily POZ domain 1.77e-16
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03098
Sequence length 204
Comment (Caenorhabditis remanei)
Sequence
MSAEQAPVEVPAADAPVAEAAPAEPTVYYTLESCDGDEVKISSEAVKQSKTLNDLVSNLH
GGAEMDESIPMDNIKKPALVKVVEWCEHHKGEPIPVDDDTVPKNVTIPEWDEDFLKIDND
ELFHLILAANYLDIKQLLNYACKKVALMAKGKSPEELRVIYGIPTDEEDEAAEKLAAEKK
KAKEAEKAAEAAAAGEAGPSAATN
Download sequence
Identical sequences E3LWI8
XP_003111747.1.11157 31234.CRE03098 CRE03098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]