SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE03740 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE03740
Domain Number 1 Region: 36-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE03740
Sequence length 177
Comment (Caenorhabditis remanei)
Sequence
MNVAFLIFLMIYRVNAQYEPQSNIDRLAQRPVLPQCPREWEWACRNGECIAHYDVCDGIQ
QCTDGSDEWNCGDGRRGGAPMAREGVAPPRESNMANTVAAVVKETTTVVAESSGTVTIQY
THILFALAAFVILSVAVVTVIKRRSRQKTGFRNRRGGHSILQQDSDEDDILISSMYS
Download sequence
Identical sequences E3LXZ7
XP_003111453.1.11157 CRE03740 31234.CRE03740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]