SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04056
Domain Number 1 Region: 95-157
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.92e-16
Family Skp1 dimerisation domain-like 0.00082
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000151
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04056
Sequence length 190
Comment (Caenorhabditis remanei)
Sequence
MSCKEPTTSPTPENNITVVSSDGKEFLLDLKLTEQSETLARLILNFEYDRTDVKKDPVPL
GNITSAQMQKIIEWLQHHRYYPKWEQNDIHYSTSFTFETWVEEYLNIPNNEMFELLNAAN
YLNIPRLFSTICRIMASRITGKSAEQIRTVLNIKTDVKNDVYTGIPIQEDSSSSEDGMSE
ISLSPSPPPI
Download sequence
Identical sequences E3MN21
CRE04056 XP_003102441.1.11157 31234.CRE04056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]