SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE04806 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE04806
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily POZ domain 4.12e-28
Family Tetramerization domain of potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE04806
Sequence length 233
Comment (Caenorhabditis remanei)
Sequence
MTTAYDDDHCSRIIKLDVGGKIFKTSISTLTKHDSMLKTMFVTRIPVKKDDEGCIFIDRD
SQHFRLILNFLRDGQMALPDSDREVKEVLAEARYFLLDPLIELCEERLETSISPYYHVVS
TVLEARKYIFATEKPVVVLRLPVYIATNGSQCYYFSETKFREFAELHHKLVSFVLITEPE
FNEDCSWTFFLKTKKITARVKGPADNNLLEDCFTQLLEDVKERRRESSVSEDN
Download sequence
Identical sequences E3LZC1
31234.CRE04806 XP_003110885.1.11157 CRE04806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]