SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE05188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE05188
Domain Number 1 Region: 183-272
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.49e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE05188
Sequence length 277
Comment (Caenorhabditis remanei)
Sequence
MATSSSAFDDEFPMEEGMPELLDDEDVPSTLPSLVEQNVDTAPKGADEFKLVKRKRKAEN
AVDVVMEDVSQPDDSSTPAETTEGEPKSAKRSKGAKGEFRVVAVPKHRYTPLKDNWVNIF
TPIVKNLGLQIRFNLKKRQVELRNPADREETTDLQKATDFVRAFILGFEVNDAIALIRLD
HLFLETFEIADVKHSLKGDHVSRAIGRIAGKDGRTKLVIENTTKTRIVVANTKIHILGAY
QNLKLARNAVCSLILGSNPSKVYGNLRNMASRGAERL
Download sequence
Identical sequences E3NAT7
31234.CRE05188 XP_003094472.1.11157 CRE05188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]