SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06751
Domain Number 1 Region: 1382-1458
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 1299-1371
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06751
Sequence length 2057
Comment (Caenorhabditis remanei)
Sequence
MPAPKTESPTPSTRPARENKLPWRLTISDISKSAPASLKRRAQESSSPVVIQKAKAKKTP
KKSARARPAPATPVGPTTARAATSARAGLARAAQLPARYREEDGPSSLKIASKKNRKSLK
KAPKKKIPKKKEDSVPSKDERSENESSDEDEDSESRKVNKKKMSATPPHTVAPSSSSGSD
SRANHESGPLIKKRRLDTSSEKMDTNSKEDDLEEEEEKEKEEEEEDTMVEDSEVEDSTEA
VLPLDIEMEEPTQSIQSTTQASPSSETEMEDQEMANTAQPEITHPEHQESSLPQARQSEP
PLSASTIKFHFNVAPIPKSLVNQTGPSTSSIFLNTPGKPAGEGITQAFSFLSPTFKGASL
TFNVPRNVKQVDSDDDEKETPRQPMPSTSQFQQQSQARISPFLRFSTAPIKESPLPIEKV
KSPMEAREERLLRRNDSEPTSSQNSVSKSSSRQHSSESRRHQGEVVNRGKNQRQIERKQH
DNSTSATRQVKVEPLEESPEATAPTKDSPLPIKKPKSVMEEREERRLQNLEKLHRNKSET
TSYQNSESQSREPGQKPDSHSLGLQDSSDSRQRHGEVVNREDNQVEREQHESSTTATRQV
KVEQLEESPEEDAFSEMFQNLRNQSLREYFEALSRRDSGSCSRASEVRDVRDKRSDSHSS
RRDDSERPSNSDSSAPRQPDSFEERRQHKEAVRREGNQRQEARSKSRGPQGRESGSRRSV
DVDSRTERKPQESPPATRQVKTEEPEESAAPEADIQNQSRREDVEAPSRREDSVLPSRAS
EVRDDDDSRLDSRFSHRPDSERPVNSDSGSSRRQNSFEGRRQHAEADRYENSTPATRQVK
KEELEESPAPEVGPIRNQSRREDVSTTSRSQDSVSCSRASEPRHRSDSRFTNRREERHHD
AGRSEYSGSGSSQRQDSRASEVRDVRNRRSDSRSSRRPDSERPGTSDYRSSRRQDYYDGR
RPQEEAVRREGNQRQDAQSRSSGQASNGDVFRRQPETDRRTDRTSYGNYGNNDNRSRNSF
NNRMDERRVVYNQGQEDIPSTSRGPEARRSDHKASERSQSKTVVGDGKRASLILFPKREY
VFQKPSNSACWDHVTKEQRELLLNEGIVDVRAVEKGKASYIKSDASKLTARDLEELATRQ
ARTLRARSESGRHPISEICAGYVKFLANDIRNRLGLVKLIVGDKVYKLRYRYVYIEGEAD
LIAKARLELDEMCLQRLEHKYNEEKGNAEQLVNYIHHIPEEVAEKMRFQRVFNEAMRRVE
RCGVQILHQQNRHTEEDNPPMNIHGRANRIREGKRCLDNFLKELANQKTHQIQIPMDIIG
EICGHQRSTINEIERVTKTIIFVDPHSGEVEIEGGDMAIQDAEAQIRERIEWRQERIPKR
EFLEMEIPGNSISGIIGKRGSTINRIRKISGAKILIPNRAEPGERTATVSISGDREQIQK
ARIEIEYELEEMRNNNRASTTSIDGRIFKKMVQIDSRYRPVNGKRGGVMASKRSTPSPVL
QWEGKKRKWSDGSEMFSLADDARTDVLRFCDGEVDAINAFTEAFISTYEPYFQGVRTVAS
RLREINRYQDALQKLQSHRGCGLGCEQLNNSLAIPQSLKDDIWREFHCGNDGRYCDVCCL
MAPSDTFRKVPVANRLMRNATIAPMELCAYVCVCEQCQSIKKDVCHTCCKSLTQKKNGLS
FDQDVPVLNKLNCIELMLINLSRVVQSVVHLKNVGNRASGMKGCGGPMIVLPTNLEKSID
GVLATLPSAEHMKIVVDTNWDRKYIVCMNRVLDALQWLKINNPEYANVKINPDFMFIVER
DVLFEVGNCSQKDADQLVRSRNVSDGVLLKEGPSVTTVQTVSQPSHGSMTAYKRFKLLQL
PYTPLGKDHPKADVWSFVNLFPRGLGGLRSVRTMKLSRRQYNRSVLLNSNNKLDLSDPEV
AKTLSSVFNKIPEFKQYWAVVKNRLQFYCAIFGPPTWFVTLNPNVTMWTDLHDKYCKILA
VEVNADNIWPKRVDAFHERVILAQDGPLGNVEHYYVRTEYQHRGLQHVHCLFWIKEKPGK
DADAEEIGTFHDKYLTS
Download sequence
Identical sequences E3MNY6
XP_003102178.1.11157 CRE06751 31234.CRE06751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]