SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06874 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06874
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000102
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06874
Sequence length 145
Comment (Caenorhabditis remanei)
Sequence
MRGFLSYHSEYFRALFSSNFKERQMDEIPIGDVSYEDFALLVSTFYPKPAFPNDNTVEII
LKMARRFLVSSAISSAEHHLITNSTIENEKLLWLADEYGMPTLLEKCIREINTVENAKQL
KKSEKYGQLSDKTKVKVYERLMDSM
Download sequence
Identical sequences E3MZN9
CRE06874 31234.CRE06874 XP_003098400.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]