SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06876
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily POZ domain 6.8e-23
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06876
Sequence length 168
Comment (Caenorhabditis remanei)
Sequence
MFAPSDQNDTILDVEGKKLHVSKAFLSYHSEYFRALFSSNYKEGQMDEIPIGEVSFEDFA
LLLSSFYPNPVFPNDNTVEKLLELARRFLVSSAVKSAENHLMNNSKIDNEKMLCLAEEYG
MPTLLEKSIRGLDTLEKAKKLRRSEKYDQLSDKTKLKVFERLVNPISF
Download sequence
Identical sequences E3MZP1
XP_003098416.1.11157 31234.CRE06876 CRE06876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]