SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE06891 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE06891
Domain Number 1 Region: 128-191
Classification Level Classification E-value
Superfamily POZ domain 0.000000000942
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 72-128
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.000000392
Family Skp1 dimerisation domain-like 0.0034
Further Details:      
 
Domain Number 3 Region: 197-235
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.00000353
Family Skp1 dimerisation domain-like 0.004
Further Details:      
 
Domain Number 4 Region: 7-63
Classification Level Classification E-value
Superfamily POZ domain 0.0000228
Family BTB/POZ domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE06891
Sequence length 243
Comment (Caenorhabditis remanei)
Sequence
MIPATHYMIKSNDNKSIWISKGAARHCERVFNIFQANPQLVIPVTAGGNELKKVATWCEQ
YKDGYTHHPPTDWDRQFLAIDDSQLSDVLTAARKLLVPPLMGICFRALCERTQQKRLEEK
QKNDGLCYSIQSEDGQVFELTAKAAKLSGTICTMISTNAVQINNKENPIRLELTAVPLAI
IFKWCEHHKMDGTVGVMTSWDKELLAIGNQELMEVLCAANALGVKTLFQMVTDIIGQPGW
GRE
Download sequence
Identical sequences E3MZR0
31234.CRE06891 CRE06891 XP_003098395.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]