SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE07704 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE07704
Domain Number 1 Region: 421-519
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.29e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 131-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.18e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00033
Further Details:      
 
Domain Number 3 Region: 564-668
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.45e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 4 Region: 1005-1077
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 5 Region: 708-815
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000022
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 6 Region: 929-1000
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Domain Number 7 Region: 274-346
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000657
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 8 Region: 1072-1152
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000263
Family Eukaryotic type KH-domain (KH-domain type I) 0.00027
Further Details:      
 
Domain Number 9 Region: 851-927
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 10 Region: 205-276
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000628
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Domain Number 11 Region: 336-412
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000107
Family Eukaryotic type KH-domain (KH-domain type I) 0.00077
Further Details:      
 
Weak hits

Sequence:  31234.CRE07704
Domain Number - Region: 90-132
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE07704
Sequence length 1219
Comment (Caenorhabditis remanei)
Sequence
MDNGHIEETNNIEIDPATGGAVMSFSYASDFPTLPDAAPATAPTAKQTNVWSRPALSKTD
VTVTFHLAPDERSNNKVKSFGNTSEESKKAQAIASATKTRIELSESKDGELTVVVKGERA
KVEEARARIIRDLQTQASREIEIPKEHHGRLIGKEGALLRNLEADTNCRIQIPNRDGPST
KITITGPREGIQRAVRHIMDVSERESKLATEHIVCPKNLVPFVRGPHNETYERLTGDGSV
KINIPPPTATNEVISVTGEKEGVARVAAEIRKIVESKKNVSSIQIQVARQQHRYIIGQSR
SGIHEVLQKTGVVVEVPSEESGSDQITLIGDAADLAKALTLVIERASSIVTQSIPAPQWL
HKHLIGPKGATLSTLVPNRNSVKIEFDDSNQIFLEGSPEEVKAAFEPLNKEVARLQMELS
IEKVKVHPTLHRHVIGRGGSLISKIKEQTGVQISIPNEETNSDEIVVEGKKDGVKKAVAE
IRSIVTKIENEKSRDIIIPQRLHKLIIGTKGSGVQTIRDAHPNVSVVFPDAKSKSDVVNI
RGDKSEVDVVYKKLTTISKEFAENNYQQTVAIFKEFLKHIVGKGGATIRKLRDETETRID
LPESGSDDGKITVTGKQANVEKAVAQLNKIQEELANVSEETIEIPQKVQSRFFGNGRRLI
SDIEEECGGVHIRFPSEKSESTKVTIRGPAGDVTKAVGLLSALAKDKEENYIEDTVKAKA
EFHRFLIGKGGSKIAKLRDTLNVRIMFPKEGDAEKETIHLLGKKDDVPKAKAALEEAIKQ
LSETVDIKINVDPKYYKNFLARGAALVKEIQDQNGGVVISFPKNGSDSNEVSIRGSKQCV
EAARARIEDTVEDYEKQITDTVSIPAQFHRGLLAGRGAKIHELQSKYNVSIRFPNNREEG
AEGSDQVTLSGRDTKVEEAKEALLALVPISKVIQLPIDMHRSIIGRGGETVRKLMQDYDV
NISIPKDNSSEDITVTGQVENVDQALEALRGKLSEYEAQAEDRKLKQWSMTINVPTDYHQ
KIIGQRGATITALKEKYGVNINVPRDEGNEVITITGYEDKAKECAAAIEEMISDLRSMFT
QEISLDSRYHPRLIGQRGKNLKKVMEDYRVEIRLPRQGAEDPNLVVVAGKDENDVYDCID
HLRSEEESFLLDNVERTQYMSPRQQESNNVRPQAGTMRVQTMGAPWQLDLGSSEQFPDMG
AQATPTTAVGGAWGSSRRW
Download sequence
Identical sequences E3MZR5
CRE07704 XP_003098297.1.11157 31234.CRE07704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]