SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08253 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08253
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily PapD-like 2.09e-31
Family MSP-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08253
Sequence length 123
Comment (Caenorhabditis remanei)
Sequence
MSEKKQYISTDPADKIKFRADPQEEQKQYLKITNKSEMKQAFKVKCTRNDLFRIKPSTGI
LDYNQSLTIVLIYRGGQEKLPAEERHHFGIYHIPAPEGCTCEGAWAEHYGPPQGEHKLRV
IWE
Download sequence
Identical sequences A0A260Z662 E3M3A5
XP_003109194.1.11157 CRE08253 31234.CRE08253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]