SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08543 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08543
Domain Number 1 Region: 155-253
Classification Level Classification E-value
Superfamily POZ domain 8.89e-25
Family BTB/POZ domain 0.014
Further Details:      
 
Domain Number 2 Region: 49-142
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000121
Family MATH domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08543
Sequence length 283
Comment (Caenorhabditis remanei)
Sequence
MRGKFLIFWSNFEQNQSSRKGCRIGDTHTNIQNLVFVSSKDRQINVKRSYGFLDLYLWNS
LLQSTEKKWEIEVEYELNIVSPVFREKKEKRGGKRCNVFKSDGIHYAWGRNNFIEWDELE
KDFIVDDCFCVEIAVKVKKMTGIYKENLRSFDKTMEEYSDVVLIVNDQKFYVLKMNLATY
SAYFKNLFIGNSNETEKTEIQLLGIDADDFQNYLEVLYGEQAIDEFTVEGILMVAYMYDT
PEVIEKCENFIQKESKKTLKKKFELSNRYNLAALMKQCVEEIE
Download sequence
Identical sequences E3NB93
31234.CRE08543 CRE08543 XP_003094321.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]