SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08549 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08549
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08549
Sequence length 369
Comment (Caenorhabditis remanei)
Sequence
MSIPLSTGTYSINGRKYRKTAYQLKVGGASATEITVDQFEDTPDVYEDEPSIGCIAPPPG
LPALKQKIAKAAKKSETTVSMDPQPTEDERITVVGGKKWMATIQVPACFIGKLIGMNRRA
LNSLENDTQCRVKTPRREQKDKPCEITSIISLECVQRCLDRIEIFVDDARKSSRPTHFVA
FSCDHSEIQQNFEVFKKLVMDSDEFHESTRNPQLFTKTSRLHLTISVVRLFDELDMKKME
EAFRVIHDEIKPLLDSAPLIADIQGIDMMNDDPSQVSVIYAKIKGEKVQKIANLVSRRLM
ELLGGNSGNSEDVVADSEDVKLHMTLMNSRYVTQQSDKKNSKNSFNAKKMLEELKELHFG
TIQINEVIN
Download sequence
Identical sequences E3NBA4
XP_003094328.1.11157 CRE08549 31234.CRE08549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]