SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08759 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08759
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000849
Family Nuclear receptor ligand-binding domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08759
Sequence length 51
Comment (Caenorhabditis remanei)
Sequence
MPYYSGRLTKLMKVNKVIETEVRERKERSHIAWVFNLFSIEYSHPEMFEAS
Download sequence
Identical sequences E3LHD1
CRE08759 XP_003115904.1.11157 31234.CRE08759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]