SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE08770 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE08770
Domain Number 1 Region: 79-204
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.97e-35
Family Glutathione S-transferase (GST), C-terminal domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.33e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE08770
Sequence length 210
Comment (Caenorhabditis remanei)
Sequence
MAVPQLYYFTIRGFGEYIRLLFLDNGIKFEDIRYQYGGKEWEDVKKTMIFGQMPALKYDG
KEIAQTGAIMRHLARVHNLNGSNEEEATFLDMFFEGVRDVRMKYVRYIYYDEGTRDDIVN
KTLPESLANLEKLFKIHSGDFIIGNKVNYADYILFEELDVYHTLDAHILDKFPALKAFWE
RMWKRPNLKSYLEKRAADKVWINAIEKGMN
Download sequence
Identical sequences E3LHG0
31234.CRE08770 CRE08770 XP_003116418.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]