SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09623 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09623
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily POZ domain 4.51e-28
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09623
Sequence length 229
Comment (Caenorhabditis remanei)
Sequence
MAPGDILKLNIGGTVFQTTVATLTKFDGFFKAMLEIDIPLKKDENGCVFVDRSPRHFDYV
LNYMRDGNVVLPVCRRERQQLLQEARYYLLDGLIELCTDRVRMVNEYDNIREIHGDNPKK
AVIVGYHPGLWGDLNECVFARKLVKAFHEHYTFYFKPITENFSYCDIDVYGVAARLESRL
PANAGEIFFNKFNFFQMAHQSVNRHLSIGQMPDVVDGEKKPDQRIYLCI
Download sequence
Identical sequences E3MJ06
XP_003103875.1.11157 31234.CRE09623 CRE09623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]