SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09628 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09628
Domain Number 1 Region: 35-129
Classification Level Classification E-value
Superfamily POZ domain 9.94e-22
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09628
Sequence length 215
Comment (Caenorhabditis remanei)
Sequence
MSEHPGKRRIKTEAPDEEEMVPKKLRKFDESVENAFDIIIVVEKVKFYLSKCHLAQHSPV
FKAMFFGSYVEADKKEVELKEMLAQDFQLFLETINGEMCVTDQTVEAILKVADKYQSSTA
LSRCERFLLKMSMLKTQKKFELACRYMFEEVKLRAVASITSSQELRAVVPEDISTLDDST
MTLLFKKTMELLPSDSQNPFRGSCGTICVHQSQGY
Download sequence
Identical sequences E3MJ15
XP_003103831.1.11157 31234.CRE09628 CRE09628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]