SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09629 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09629
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000165
Family BTB/POZ domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09629
Sequence length 229
Comment (Caenorhabditis remanei)
Sequence
MSSPSSSVIQLDDEMMEDEVEIKKKMDFNDADPNIVDAVIVIEKHKFHVLKGNAARHSAV
LYEKFFGEKDSRVDSVTIEESPQTFQYFLEVIHGIPTINDNNVEKILEVAKKYQAPFAVQ
TCEKFLISNGRMTDKEKLRLSMKYDLTELKEKLIVGVLDSKDLFHLVPKNVEGLDRETKM
MFFKKAIDIHGFRKSRTPSPDRILRIHRNWFRRSSESPIQEIVYPEVRL
Download sequence
Identical sequences E3MJ16
31234.CRE09629 XP_003103915.1.11157 CRE09629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]