SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09647 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09647
Domain Number 1 Region: 270-342
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000577
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09647
Sequence length 404
Comment (Caenorhabditis remanei)
Sequence
MDEATLLSSAPQEVYIPQKLKAFMSEPQGSALVAALESQFQCIISVINDFLSVKSSIPGM
QADLSQIENILRDVWQKRDIQLMIREAALNASCTHTCHTILPRAYCAVVFFFSSDIKRRS
RCNDMIIDHFTGKVTMFGTEQSVNTAREVMIECLTEHFGLLEIEIPITRRTARMGYNSNA
IEMTQNSFNPEVPPPQLPAVCHPPFLNNIFSISEPNAILTSTPAPGPTRDDSSLLPFDNH
LLFPSDFSVPPPQLRPVVEAPPKTNNVEKIKHWIPTAEVGKILGNRAAMKKQIEGQFNCV
ITVHTEVYSHFGMTSVEIMAQNKEQCRGARNAVMSLMSAYQEKAGGSSVNDSGVNSPVSP
MTTESPSTTPEKRGGRQYHRSSFRDQPKVMLALTPRKIAPAVTE
Download sequence
Identical sequences E3MX07
XP_003099340.1.11157 31234.CRE09647 CRE09647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]