SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE09709 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE09709
Domain Number 1 Region: 94-169
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.07e-32
Family Skp1 dimerisation domain-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily POZ domain 5.89e-21
Family BTB/POZ domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE09709
Sequence length 171
Comment (Caenorhabditis remanei)
Sequence
MAAEAKPERNIKISSSDNETFTVPRNVIRLSTTINTLLQDLGLDEEDAVNTDPIPVQNVT
APILKKVIAWCTYHYQDATPTDDADNREKRTDDIASWDVEFLKVDQGTLFELILAANYLD
IKGLLDVTCKTVANMIKGKSPEEIRRTFNIKNDFTPEEEEQIRKENAWCED
Download sequence
Identical sequences E3MX48
XP_003099315.1.11157 31234.CRE09709 CRE09709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]