SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE10659 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE10659
Domain Number 1 Region: 78-219,265-374
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.81e-27
Family Calponin-homology domain, CH-domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE10659
Sequence length 376
Comment (Caenorhabditis remanei)
Sequence
MSTLGRSKTPSRDDSKKPSVFEKLSGTLSRKKKLPEEEQNGQGGGQHGGAEEDEVLELEL
EGREALDSSLVPVLARNIWLEEGETRRYLTKETARDQKLAQVVDLLIYWLNEELADQRIV
VRHIQEDLFDGQIIQKLLEKLEQIRIEVPEVSQSEEGQRQKLQIVIQTVNRILGQPRDQE
KWSADLIHQKDFTAIIQLLVLIALHYRAPVRFPDNVVANVVVAQKEHGQVKTHRITEQIT
TVQTELAPKGTRDAFDTLFDYGPDKLAHVKTSLLAFCNKHLNKINLEVSDLDTQFQDGVF
LVLLVGLLEGYFVPLYHFNLQVHGHEEKVKNVSFAFKLMEDAGLEKPRSRVQDIANGDVK
STLRLLHLLFTKYKHI
Download sequence
Identical sequences E3NES6
31234.CRE10659 XP_003093101.1.11157 CRE10659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]