SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11086 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11086
Domain Number 1 Region: 1306-1631
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.51e-79
Family Ankyrin repeat 0.00000757
Further Details:      
 
Domain Number 2 Region: 465-749
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.98e-49
Family Ankyrin repeat 0.00078
Further Details:      
 
Domain Number 3 Region: 313-540
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.01e-23
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 1884-1963
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000292
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11086
Sequence length 2702
Comment (Caenorhabditis remanei)
Sequence
MASLQAFRPLQLNETQVCVISSYPPREMSEINDNSAEHSAAPCCPRRTRSPLSKRIRQRE
TLAIGGMSDLVEFDHLIPFEADLNPEKNGIRHRVFSTFYHFGAKLYDCLYAVAIEIPEDG
ETVPISAVLKSLNYEHFLTPECRFPPVSKLLDVIEKREMDDCQILFKISDLIEDHKTEKP
ETFGPYDPSNPNRVPIQCAVDAATTVASMAYCFLASSFAEDLMKAACPEAYGYDDEEDES
DDEEDGTEDDDAVKPPKEKKIPILNHRKLPPVEPIELQQNAMLLLATRIGIEQFLILANE
MGKVQFQGHKLSTITPLMEAAASSSELIVNRLLKMGADPNVQSVPNCNTALIYAACTDAR
DVVREILMSEGPIKPDVYLINNFYHDALMEVALVGGVDTLKDFLDAGYPPKFLDVQSTTR
QESALTLASLKGYSQIVSTILDYHDKHPPTTSDDLRDACLERYSALMEAAMEGHVDVCKL
MLSRGTPTEMSENVHIEAQSPLLLACSGGYPEIVEVLLAAGARVDEISNKNSTCLMEACC
GEQGDQVNVVRLLLAKHAEVNYLHPDTGDTPLSLAARFGHIGIMKLLVEKNGDLTAGKTS
PIVEAAAKNKLECVQFILAHCKAIPQEQLSRALVAGADTGCLQIVEELVRAGADMNFEQD
ERTAMMKAAKNNRYDVVQFLVNKGASVNFKSSKNDATALSLACSEGHMEIAQFLIRNGAD
PMLKMDDGVNCFMEVARHGSFDLMSMLVEFTKGNISLDKEPPKLGINRCKTNKKKKKNGT
GVGCGMDTSEMLMMLNGVLPKRKGSKQPGMHDLPYSTHEIDMLTHLLKLQQQMVSYEAHK
SADKDTPNLNKVLEGLQIGYGFTAEGKINFPPPPCRVDMDKLYNGELVPNIKLWAELVAH
GWMEMERKVGRPVEMSSFQICSEGHSTNAAAAVSAVAAAATGMDSQAYLASVFAKMNNGE
EMPRVPATVGSLNAASAAMTGISFHSDDAMRLFGGASFATKMVSDNKKTCNHQQFATVHH
IQEAAFRAALLKMDAMYKERKGAAISVVDMESNFPIDAKETRITAKSPPVGPKTTSMTVP
KPEKNSAEVEVTTEQPGVDMSFQKDGMEPSQVYPKILKLAIEMEQMYRSNPTDKAREIAV
TTAYIASTLPEQICLEMNVESGDRLLKKLLSGMSEKQKLAMMTRARKTITTETDNELLRR
SADSLSDKRLKEEYLKIFRETADCAFYDKCVREKKLKAAEQKHARTSTANVGSQNSMAPA
KSQAGKVVASQQQSGQLRRTHSEGDGAERAKARSNAIDKSTDTTLETPLTIACANGHRDI
VELLLKEGANIEHRDKKGFSPLIIAATAGHASVVEVLLKNHAAIEAQSDRTKDTALSLAC
SGGRKDVVELLLSHGANKEHRNVSDYTPLSLASSGGYIDIVNMLLSSGSEINSRTGSKLG
ISPLMLASMNGHKEATKVLLEKGSDINAQIETNRNTALTLASFQGRTEVVKLLLQYHANV
EHRAKTGLTPLMECATGGYVEVGTLLIEAGADPNASPVQATKDTALTIAAEKGNDKFVEM
LLDHDAAIDARNKKGCSALWLACNNGHLSTAEVLITKGADPDTFDNRKISPMMAAFRKGH
IEMVTFMVGHAKQFPNETDLSRAVQAIESEETKAKCNSCIDVIRNAKKAQAESAEKAANS
LLEQIDEENAKNEEKKQKQKEKKNKKKEAKKKEKVEGASQPPEPEPEPAEENVEEPEPAP
VPEPEPEPEPENVPVPEPTPAVVEEPPKDPPKPRRNRRKTNPDGVPKGPKVVKEVKPIVE
EEPSELPYAPIKVTIPPPAQVQAPMVSPSSYSESEEWCKAGKEGKKARPAKRPDGRQTAP
SSGGSSQPKNASATSSVASERQNPWEVDTKGSKVFEFTVLGNIVSRVIGKSGSNINAVRE
ATGAQIEIDKLGGSKEDDRHITVRGSADTVSHATNIIYLLIHDKNMLITDAIRTVLRGNS
SVASSLSSEGTSRSAVDSTSYAPSSIPQSMSSASLARQSSSPAPVSTQPQAHPKPSKSHG
HQTSKDHSGGSSGGGNVWQQRMAARQEKEPAPISQSPKPTVPSPQQVRQQTPPQPIRQQS
VPVQTATVPTPLKATTPTPARATTPLDRVIAPPVRRETPVAAASVQPVQQVHVPQARQEP
VSAQQQQRLPEPVQRHVEPSGQAQRYPEPISRPQSSAHPMQNVQQQQPTFSKAPGTRVST
DFSRAPGPPTQAASNVPQTKAEVFDDRLAFGQFKQTAPGPPGTPNAQSASSLNTSLNDPS
NGSIDFDISKLRMFDDGKTGGNIWGKGGEDSDTWGGLFTQFFPTSSTASVSSPLSSTVPT
PMRSETRNDTEWPQSDAFNQLLSEQSQMSSNLGASTSSRQQQVTPGMSSLESKGWMPSSF
TPSARDPNRTQPPLFARSPSSSAAATNPSTLLQQQQQQQQQQQQQRYQQQIHEQQQQQQQ
ALQQQRMFQQQFSQTQSTLQQQQQQMYQLRMNPAYGQLAQQLLDHEKTSAPGPSHQPPSS
SQLANSYYPSPSYTDNSVLGQLNLATMAQRGIKQFDGFNNDQPVNDSILAAIIEQKKSQP
VLPSSGYMHAAQEQPPPFVGPSSSVTSQRMGMMRPQPQPQPFVTTPQQPPPGFGSLGAAP
SNQGTVSQRQMYQFQQGPQQAPQFNPLTPLDWNTVQQQQQRQANPQNPSQSAPTKWNNWN
NI
Download sequence
Identical sequences E3M5G1
31234.CRE11086 CRE11086 XP_003108482.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]