SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11379
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily POZ domain 3.92e-27
Family BTB/POZ domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11379
Sequence length 161
Comment (Caenorhabditis remanei)
Sequence
MEEFSDVVLVANNEKFYVSKLYLAAHSSYFKALFLGKFDESKKSEIKLTGTDAEDFQKYL
EVLYGENAIDEFTVEGVLLLADMYDTILVVRKCEEFLLEKSTTSLKKKLQMSMKYHLEDL
KKQCRNKIKSVADIKSVLPGDIHDLDPSITTQFLEIALSIQ
Download sequence
Identical sequences E3N738
31234.CRE11379 CRE11379 XP_003095786.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]