SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE11807 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE11807
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily PapD-like 9.42e-37
Family MSP-like 0.000000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE11807
Sequence length 127
Comment (Caenorhabditis remanei)
Sequence
MAQSVPPGDIQTQPNAKIVFNAPYDDKHTYHIKVINSSARRIGYGIKTTNMKRLGVDPPC
GVLDPKEAVLLAVSCDAFAFGQEDTNNDRITVEWTNTPDGAAKQFRREWFQGDGMVRRKN
LPIEYNP
Download sequence
Identical sequences A0A1I7TVD2 A0A2G5TMY9 A8VT33 G2J6F0 P05634
31234.CRE01807 31234.CRE02082 31234.CRE02309 31234.CRE11198 31234.CRE11701 31234.CRE11807 31234.CRE11889 31234.CRE13160 31234.CRE16241 31234.CRE20483 31234.CRE26299 31234.CRE27058 31234.CRE27068 31234.CRE30266 6238.CBG02775 6238.CBG02877 6238.CBG25598 6238.CBG25599 6239.C04G2.4 6239.K07F5.2 6239.K07F5.3 6239.ZK1251.6 CRE01807 CRE02082 CRE02309 CRE11198 CRE11701 CRE11807 CRE11889 CRE13160 CRE16241 CRE20483 CRE26299 CRE27058 CRE27068 CRE30266 CRE31669 NP_501722.1.50509 NP_501760.1.50509 NP_501762.1.50509 NP_501834.1.50509 XP_002631023.1.8413 XP_002631103.1.8413 XP_003090305.1.11157 XP_003090359.1.11157 XP_003097275.1.11157 XP_003097384.1.11157 XP_003101690.1.11157 XP_003108835.1.11157 XP_003108950.1.11157 XP_003109071.1.11157 XP_003111438.1.11157 XP_003113539.1.11157 XP_003114163.1.11157 XP_003114180.1.11157 XP_003116802.1.11157 XP_003117016.1.11157 XP_003117476.1.11157 C04G2.4 K07F5.2 K07F5.3 ZK1251.6 CBG02775 CBG02877 CBG25598 CBG25599 C04G2.4 ZK1251.6 C04G2.4 K07F5.2 K07F5.3 ZK1251.6 C04G2.4 K07F5.2 K07F5.3 ZK1251.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]