SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE12484 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE12484
Domain Number 1 Region: 146-213
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-20
Family Skp1 dimerisation domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 73-134
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000523
Family BTB/POZ domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE12484
Sequence length 223
Comment (Caenorhabditis remanei)
Sequence
MIIFIILFFDTSSSMTYCFIISIHTRFSRCHHLFNKLFQMVKSPKSSKKGGKGAKPKQAV
HMVHVNEHLNTSFTILSCDGVEFKTDGHTIKQSKILNLASKNLDQPTTPIQVDKVKGDTM
KLLLEWMDQHKYDGPYISKSGPGLRLPTWDFRWLKELDNQQLFDLITATNDLQIKQLMDY
SCKTVANMAKGKNPDELRQIFGILSDEEEAEIALYEPGPSNAK
Download sequence
Identical sequences E3M753
XP_003107729.1.11157 31234.CRE12484 CRE12484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]