SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE13972 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE13972
Domain Number 1 Region: 13-162
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000142
Family C-type lectin domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE13972
Sequence length 163
Comment (Caenorhabditis remanei)
Sequence
MVVSWTEQGRTTLCVEVFSGTGTAFYAQEQCKTRGATLTGVQDGNERSQIANAARIVNNA
NGGGSDVWIDGKRRAECPWKAACAPNDTFEWTDGHTTGTAGFWWPGIEPSGSWNDQWRFQ
SCLVIHVSAADGQMGNWGYPHGSMDDEHCQQTWRMYACGKKPS
Download sequence
Identical sequences E3M8L0
CRE13972 31234.CRE13972 XP_003107473.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]