SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14368 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31234.CRE14368
Domain Number - Region: 21-48
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.0458
Family Rad50 coiled-coil Zn hook 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14368
Sequence length 202
Comment (Caenorhabditis remanei)
Sequence
MYINAIFHSGCPSSSLAAEPIDFNERKCPTCMQKIDRNDPKWTINRLPSPIMGTQLEAAA
SIVIKPSNGHFRSYKIGDDLHIGICDSRGVVTSFWTNGVVSEKDTWHKCVVLVDLRPYFF
ENMENLDNCIEFFVETEKMTKRFHKSKYRETTWNCFDFVLEFLKFINFRSNYSKIDFSRE
FSTKKVQNVVKYCTLYEKLRME
Download sequence
Identical sequences E3NLL5
CRE14368 31234.CRE14368 XP_003090707.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]