SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14413 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14413
Domain Number 1 Region: 71-171
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000228
Family Nuclear receptor ligand-binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14413
Sequence length 172
Comment (Caenorhabditis remanei)
Sequence
MFEEKPVKFDEPSTSTVSHPPLPTTSQMMTEESSRTSSFDGGYCSSLPSSSNVIHPSPPG
IGLTTDHNSILQYYHSMETGLCSRRRIMYTNTDMDYILDSHSTLQCPYTVSDLRPHDFRN
FRGMLRHDFVILFDYATRFPDFNSFTSHEKNMFYRLILAVDFILSSAYYSAK
Download sequence
Identical sequences E3NRE5
XP_003089026.1.11157 CRE14413 31234.CRE14413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]