SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14540
Domain Number 1 Region: 9-108
Classification Level Classification E-value
Superfamily POZ domain 5.89e-26
Family Tetramerization domain of potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14540
Sequence length 214
Comment (Caenorhabditis remanei)
Sequence
MDENCALRKLNVGGTIFSTTKRTLTKCPGRLKMMVEHETVPGTDENGNIFIDRSPKHFEL
ILNFLRNAKINLPDSLEEVKEIREEAHFYALGDLKKLCDEKLKSQIIKNDDEYMQIVTKP
PVFVFHYSPIEPEKFTFSYNFDIEDFLKEYRDKFDIYFKARKAKNNEKVLWWWTMHYHNT
YYEACDQQGVPGYIGVKLDIDRDIWRFSEIAGLE
Download sequence
Identical sequences E3M9F7
CRE14540 31234.CRE14540 XP_003107193.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]