SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14608 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14608
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000549
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14608
Sequence length 195
Comment (Caenorhabditis remanei)
Sequence
MEQGPSSRSEVVPPHNENPKFKNLIVLIEGKPFFVNKKMLSRRSPILAELIDAMEPNQDT
ITLTDVDPSKFQNFLDFIHERRLSYNEGEFMDILEVAEKFSAFSTYNNCQHLVVISREIY
PVDKLEIAIKFKFEDPLKCAIVDNFRSVYQLELVMSSEIILQDVYLMGLLFNRAISIRHS
PTRFMGCNSLNSLNS
Download sequence
Identical sequences E3M925
CRE14608 31234.CRE14608 XP_003107297.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]