SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14613 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14613
Domain Number 1 Region: 36-134
Classification Level Classification E-value
Superfamily POZ domain 5.89e-24
Family BTB/POZ domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14613
Sequence length 228
Comment (Caenorhabditis remanei)
Sequence
MSEGAPPSKRLCGVLLRRETEETSPRKNILEFDGSDTNLHDVVLLVQNRKFYVNKKQLAV
HSKFFHRMFFGGFEETEKDEIEIKDLDATQFHIFLEAVYGVLYVDDSIVEGLIELADRFD
CEHILKKCKEHLMEMKNGSSNKLLRMAIRYDMKPLKTKILSSIKTKRDLRDLIRPTTDGF
DHETMNFLLEKSLGMEQGPVFFEDGFPGSSTIESARTVSRWLAMRDTD
Download sequence
Identical sequences E3M931
CRE14613 31234.CRE14613 XP_003107350.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]