SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14614 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14614
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000785
Family BTB/POZ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14614
Sequence length 203
Comment (Caenorhabditis remanei)
Sequence
MAQPGPSSSSKKTDAPKFGADPRLFDAVVRVQQQNFPVKKCVLGEHSKVFYNIFFVEKKE
STDENPIEFDDLREFDFQHFLEVINGQTNIWDYSVESVLKMARRFECEQLERRCVSHMMH
DSRESLKNRFKWAFEFDLEELKTKVLSEVKTIKELKAVMPSSDVSTYGPEDTFLLFEKSL
DVQGIRKKIGPPIDRMRLIRRLE
Download sequence
Identical sequences E3M932
XP_003107141.1.11157 CRE14614 31234.CRE14614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]