SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14645
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000216
Family Tetramerization domain of potassium channels 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14645
Sequence length 236
Comment (Caenorhabditis remanei)
Sequence
MTVQLDIGGTIFRTARMTLTVKAQGSLLARVAENMNAAYLVFADRSPKHFELILSFIRYG
SDIDLPDSEEELEEIKNDAKFYELYYLVEKCDEKLSIIEANKPKLSVINSEKELNQKIAC
LGRVRPIFYYFQAPNSEFQPMIVIRFNSKHWGEVFHSTDALTLVNQYKSVFDIHFMPLAH
DATYFRFSIHDNTLTKFATISHARCNKTFIKFLEKRITRFLAEKFNCYIPFIDVFE
Download sequence
Identical sequences E3M9A9
CRE14645 31234.CRE14645 XP_003107166.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]