SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE14673 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE14673
Domain Number 1 Region: 122-216
Classification Level Classification E-value
Superfamily POZ domain 1.06e-24
Family BTB/POZ domain 0.0061
Further Details:      
 
Weak hits

Sequence:  31234.CRE14673
Domain Number - Region: 4-107
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000371
Family MATH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE14673
Sequence length 282
Comment (Caenorhabditis remanei)
Sequence
MKDYQFYYSAKEFHCDIPWKLAIRPMSKAPYVYLVCSKFTKSDSYSIDARVEMRYFKNGE
ADCIKSATFTNVHNLMLFNNFSSGIPNDYIVDGNLSVEVTVKIDKTVGITGKLRSFDDEA
TKKYSDVVLIVKNEKFFVNKKYLASQSSYFESLFFGNFDESKKSEIELKDIDPYIFHEFL
EVLYAKPAVDEDTIADILKLVDMYDAASVVERCEEFYIYRSKQSLEVKFHAAVKYNMVKL
KEKCMAEIKTVEDFKSIIPEDSKQFDTDLWKELCQKSLTLSK
Download sequence
Identical sequences E3M9G7
31234.CRE14673 CRE14673 XP_003107086.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]