SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15076
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000817
Family MATH domain 0.019
Further Details:      
 
Weak hits

Sequence:  31234.CRE15076
Domain Number - Region: 126-209
Classification Level Classification E-value
Superfamily POZ domain 0.000275
Family BTB/POZ domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15076
Sequence length 275
Comment (Caenorhabditis remanei)
Sequence
MLVRNPRTTLYITVACKVNNSIGFWKVKANVTIKIRNFNNERDSLIHNCGELSFGNHYLD
MLNLHRSTNIRLADLIEGNSGFMKNNEMIMETDIRVVEVEGFHHPLVINNRLPPVNSKNL
FRFIHPNDTFYCNKAILNAHVKCGRDFDISNMDFISFKQPSGELFEEFLDCVYGFPISIP
CLDSVQSLLQLSVSFKMRAVARRVEAIVIQRPLVYNNDISCRKIVVTFNLRRVMHTWLNR
QESVNKKDVEDLDVEKMSGEIMKAIVMRVFEVGWK
Download sequence
Identical sequences E3NPD5
XP_003089736.1.11157 31234.CRE15076 CRE15076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]