SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE15681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE15681
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily POZ domain 1.37e-22
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE15681
Sequence length 116
Comment (Caenorhabditis remanei)
Sequence
MPTMSIYESTFAKSDKTDATLVVDGKKLHVNKALLSSHSDYFNTLFNGEFKEKSMTEIQI
EDVDFEDFALVLCIVTNTFIEIERRKIEPLLKLADRFLLPKAKRTLEMLKIVQFDG
Download sequence
Identical sequences E3N862
CRE15681 31234.CRE15681 XP_003095428.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]