SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE16643 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE16643
Domain Number 1 Region: 9-223
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.48e-60
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 3517-3624
Classification Level Classification E-value
Superfamily E set domains 4.01e-26
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 3 Region: 757-857
Classification Level Classification E-value
Superfamily E set domains 1.73e-21
Family Filamin repeat (rod domain) 0.0021
Further Details:      
 
Domain Number 4 Region: 3455-3542
Classification Level Classification E-value
Superfamily E set domains 4.2e-21
Family Filamin repeat (rod domain) 0.0023
Further Details:      
 
Domain Number 5 Region: 2865-2901,2964-3021
Classification Level Classification E-value
Superfamily E set domains 2.28e-17
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 6 Region: 3103-3205
Classification Level Classification E-value
Superfamily E set domains 3.2e-17
Family Filamin repeat (rod domain) 0.0048
Further Details:      
 
Domain Number 7 Region: 3340-3429
Classification Level Classification E-value
Superfamily E set domains 3.38e-17
Family Filamin repeat (rod domain) 0.0025
Further Details:      
 
Domain Number 8 Region: 676-770
Classification Level Classification E-value
Superfamily E set domains 5.34e-17
Family Filamin repeat (rod domain) 0.0025
Further Details:      
 
Domain Number 9 Region: 588-677
Classification Level Classification E-value
Superfamily E set domains 7.34e-16
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 10 Region: 849-942
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000014
Family Filamin repeat (rod domain) 0.0028
Further Details:      
 
Domain Number 11 Region: 2401-2479
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000187
Family Filamin repeat (rod domain) 0.006
Further Details:      
 
Domain Number 12 Region: 2301-2392
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000214
Family Filamin repeat (rod domain) 0.0052
Further Details:      
 
Domain Number 13 Region: 2772-2862
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000631
Family Filamin repeat (rod domain) 0.0063
Further Details:      
 
Domain Number 14 Region: 2209-2295
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000867
Family Filamin repeat (rod domain) 0.0051
Further Details:      
 
Domain Number 15 Region: 2134-2211
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000147
Family Filamin repeat (rod domain) 0.0064
Further Details:      
 
Domain Number 16 Region: 2695-2781
Classification Level Classification E-value
Superfamily E set domains 0.000000000000734
Family Filamin repeat (rod domain) 0.0054
Further Details:      
 
Domain Number 17 Region: 959-1041
Classification Level Classification E-value
Superfamily E set domains 0.000000000000867
Family Filamin repeat (rod domain) 0.0095
Further Details:      
 
Domain Number 18 Region: 1093-1161
Classification Level Classification E-value
Superfamily E set domains 0.00000000000234
Family Filamin repeat (rod domain) 0.005
Further Details:      
 
Domain Number 19 Region: 241-328
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000034
Family Calponin-homology domain, CH-domain 0.0059
Further Details:      
 
Domain Number 20 Region: 3023-3099
Classification Level Classification E-value
Superfamily E set domains 0.00000000000554
Family Filamin repeat (rod domain) 0.0043
Further Details:      
 
Domain Number 21 Region: 1940-2028
Classification Level Classification E-value
Superfamily E set domains 0.000000000048
Family Filamin repeat (rod domain) 0.0053
Further Details:      
 
Domain Number 22 Region: 3203-3293
Classification Level Classification E-value
Superfamily E set domains 0.0000000000554
Family Filamin repeat (rod domain) 0.0058
Further Details:      
 
Domain Number 23 Region: 2606-2681
Classification Level Classification E-value
Superfamily E set domains 0.0000000024
Family Filamin repeat (rod domain) 0.016
Further Details:      
 
Domain Number 24 Region: 1902-1949
Classification Level Classification E-value
Superfamily E set domains 0.0000327
Family Filamin repeat (rod domain) 0.014
Further Details:      
 
Weak hits

Sequence:  31234.CRE16643
Domain Number - Region: 340-426
Classification Level Classification E-value
Superfamily E set domains 0.0193
Family Filamin repeat (rod domain) 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE16643
Sequence length 3696
Comment (Caenorhabditis remanei)
Sequence
MGKQGEEARQKWIDIQLHTFTNWINEQLQGNAIQDLTQDLSDGVNLIRLVEILQGRRYYG
KVYDQEPTEIQKLMNVQMALDALREDGVKTVNIGSHDIVDGNEKLILGLIWCLVQRYQIA
CKTKIPPKKLVMAWIQSALPELKLTNFRTNWNDGIALSALLEYCQPGLCPEWRNLDPSAA
RENCHRALLLAERYLEVPGIISSDHLSSPHLDELSCLTYLSYFITKGAPGYRATLKKVTL
LLPDCNVEDLEHSWSDGFLLAHLVEACGGTVPELDQMRFENLNDFVENVAIVLDAAADIG
VGSLVGADDIADPQGEHLGTMALVAALCSIPLEQQVKYTDCYVNQQVNLDLAFTSGNEVR
IEELDVQVTGSSGEVYSNEAIKLRKSRTVQGANLSLIPVEPGFLQVRIYCQGSELPASPI
SLQVHTQEETRSTSRATSRAHPENRHPESSSATTSVVRTTVSPVGTQKEQGGIAQFSSET
EVDISHKSFAQRRLHIIKQLEAQHVSHLAQTKSHHQPHQQQQQHHHTSPSIVQVVQPTPP
PPPTPAQSSSHIPPPPPIPAVLEASAYREMPLTRSPDVGLVSFSGLSEPCSVGSIVEVVI
NAHGDAVSGSVYVEAVSPTGTVHPCTVRHQNNSYMATFTPQEVGLWRIGILYDGEHIRGS
PFACQVFDSGLVNVYGLDVGLVGQELKFSVNTSQAGHGNLSVTVLRHGREIPLTIEEQGN
SKTYQVSFIPDGAGQYKIHVLLNRMEIKGSPFILDIADASSVSTYGENLRSASVGKTASF
MVHAVGADAKDITAHVTAPSGETFPAKVVTLDDVTFQIEWTPKEPGEHSVDVMLADQRVP
DAPFACNVGAPDLVHVRNMPRRISPTKLNTDHSFEIDASAAGSGNLEIMINGGRVPCRVR
ELGSRQYMAIFTPTQSITHTIEMRFNGEHVSGSPWKLPVEDRGERRQEMERTMSYYSELS
GPGLVRAPVSRIAHFDITGEGLELSDIQAKIVGPDNREFPIRIIPRTAGKYTAEYQIEQV
GEHHLTVWIAGRKVDGSPLSVAGYATEKVRLEPLGGGSPNQPVQFYDVHVQEDTVANRPD
KPSYYSQLYVIPAVDAVEAGKGQLEISVNQGRVPNNVQMQGAGRCLVTFIPQHAGTYVID
VTFNGEQVHGCPIKVEILPKQVGQQIHANLTPTAVSTAISAGGTSSISGAFRETARSPLS
ARSPTSPTLLQHARQRSEETMLRSPQLLRESRKADKPWQSSYAPSPSRNAFSQSPHRDWS
ASTVYDRVYGSNSDVERTLSPSDPSRNRNIRETTTVIHRTPSPTGLRSTQITETITRTTH
RSPSPPRGASNTSYGSVRTQQFAERIARSPSPPGYEREFVEKRTTYRSPSPARTSSVAHS
HISETPLSPIQGMDTPFDTNERLKKVERMDPLADEEEREQRRAQLERDHKNTLGYTVAQY
GDSRSTPERRYFGDTLDKKDRPPSAGYYSSAQQQRSTSPEYSTVYERYERNPEKPDLPPP
RVEGHVSASYKGYEPVYSEVTTTRTTTTTEYENIDKKPSVPKKRATTPEGHVEPVNDNEQ
KQTFLRTQSEKVFEPVETNLHRSDEKESIYDLPPQEKLHKYPEEPTIALSEKDQSSARAA
YAKGREDDIYDASRNVSYPPAPKIDYSDRKDELSNYNRGKEDHYGVVGEYPTAPKIAYSD
SKEAVVRDQYARAKEDPYGTIEECPPAPEIALRSDDLKETKNEYIRAKNADQHAEQSHPT
PPVIEISKAEQARRTEEYLRVKSEDEKILAKHGFTRKPEPSIEIQEPVTEQIRDDVVEAA
MAPEVPLRPSDELPHSPVPSSKSTPATTPKMSLKFRKDGKEGKPFDFGKSKFVCKHDVIK
RGKEVEVKLEGLKLGKEDALRIVVLPPANKSVAGANGGPQLEVDAKVKKSSSKYEITFKP
TEVGTHKVFAYVNEIQHPLSPFAVRAYDAAEIIVGEIPHQSNLNDTVEFTVDAGRAGFGN
LEMAIKDADGVIIPSHVAQLESGSAKFLVTFTPATKGPHTVNITFNKEVLKRESNSLSLF
SIKNIFPDSPFEVNIVDAPLPPPVVLEAPAGVAAVASPSLSKKELKEQEKEKKREEKERA
KREKEERATLKKEKKSKSYRFPAKTTVSKIPSLSRVGQPSSLVVEVSGHDQLEIRVLDSK
KNEIGTDIVEIEPGHMQINFTPVQVGDHEIDVRYGGVPVTGSPFTCRAYDPAKIKVGAIP
KGLLDKHVYFTVDASEAGVGNLEVAVCEGRVPSMAHALGHHKYDISFVPKEDIDHTITVR
FNNEPVPGSPFICQLVATTQATATGAGIERIPVDEETEIQILTDDTEASPEARVRDPQGN
DLPVNVTRSKDNETLHIATYVPKCVGNHLVDITLGGEPIAGSPFTAKAYDARKTVLSPPI
NAAVGKPATFVIDAARSGAGNMEIIVSVDNRNVPNFVQAEGQARFKVSFTPQDAKDHTIS
VRFNGISVPGSPLICSVSPAGTVPAAVVLPAAAAIGTGAAVASTQHAKHTPQHSFEAVPV
KQTTTTVLQKTPEIKERVEKTGLARELNSAQVGQKKGFTIDNINKSSDCNVVITGEHLVE
IYLDHEIIEEFVMNIKDERHTLPPVCLAGQKYSFDVNSDDKNQVRVTIREPSGRMLPVQM
EDLPDGGVRVSSRFKEVGIHSIDVFVDDQPIGERRMQTVIDPLNGAQLVSEPKREIVGEQ
TELKILIDSGVESQVEVIIEGPDREDNEVHMKKISETLWSAVWIPKVEGEHELSILVAGE
QIPGSPFPIHVLDPSAVRVIGLKNAPVGVEQQFSVDYTNSGASIATIEVRHGDKPIPTTV
KKMKPGQLLCTFTPTNDGPHQVDVIIDGVPLTEGPYEVFISHLGTVRASGDALRKAQRAR
TARFEVINVEQNRGELDVMVSGKHQTRINFRMIFCFACFVCACLNVHVLLYLSLSVGFKL
IFSFQIHINTLFLQYLMVKFRFSDPKGGPLPVRCYKQQDDSYWVEFTPEHLGTHTIEVTF
GDVPVPGSPFKTEVIDVKNVQVRGLSDPILLRHATTINVDRRNAGNGELSVEVTDPSGAP
LRTETLKSPGGEDRITFLPNQTGEHKVNVKVAGFQLPESLSGYPQTILVSEQEKPAVYGA
AVDQSIKIGEPASLIFDPKKTNGGLKIHVSGPDRQKIHHNVMRRPNGTSEVVFYPEETGP
YTVSIDFNNRPISGSPFLVNVVDPTKVIVNDLDMDRDGTLLLRLGHSNSFDVDATAAGPG
KLRAEVRDSEGALLGNGPVVEDMGQGKYRVRFNPDQHGRYEIYLYWNELPVESAFPVRAR
SSAEDLPTTSRAVREPVPPPVTTTYHTREKSSGSSVDDEINRIMVRGDGLHRAVLKEHNE
FIIDGSDINKEGRITATLLGSKADIPVRIQQLGHNVYKATYTPLTGGTYELHILWNGKHV
KGSPFAVSADTSAHLADLIDVDASTLKIGIINENIKTVIDTRRAGSGQLSALCMGPTKPA
YCELYDHRDGTYALCVRPAEIGKHTLVIKYDDEHVKGSPFVVHVSLPPDPSKVRVYGPGV
EHGILSLFKSNFVVETRGAGAGQLTVRVRGPKGAFNVEMQREKKNERTIHCKYEPKEPGD
YQVEVKWHGEHVPGSPFLVMIVDTEKELSRFLRGEAPSPTPATPFIPPGWVAPPPPMFQM
QPGQQRFLPPGHFGPMGVPSPYGSVPPPNKHKGRNH
Download sequence
Identical sequences E3MAW3
31234.CRE16643 CRE16643 XP_003106824.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]