SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE17162 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE17162
Domain Number 1 Region: 97-155
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000288
Family Skp1 dimerisation domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 15-77
Classification Level Classification E-value
Superfamily POZ domain 0.00000000204
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE17162
Sequence length 174
Comment (Caenorhabditis remanei)
Sequence
MNTEFAAKTNDSLPNYIIETDCGQQWQVALKVINQSLTIMQEIRNRGSEESPILISEIRA
EAMEKVLEWCHRHKDDAPFVANRPCIKHHRHSKARPIPLPKWDKTFLGDMNTILLLQVLD
ATTTLKIPKLMEYTCQIVGKLAMKKTADDIRKLFTDGEEGRDLTQPGPSHSRRM
Download sequence
Identical sequences E3MAG7
CRE17162 31234.CRE17162 XP_003106850.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]