SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19166 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19166
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000011
Family BTB/POZ domain 0.0016
Further Details:      
 
Domain Number 2 Region: 78-137
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000314
Family Skp1 dimerisation domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19166
Sequence length 163
Comment (Caenorhabditis remanei)
Sequence
MVVGQRNPLFKIRSSDGQIFVIQDWLIQKSKSFSVVYPFMKDSAQPLQTTVSSFILEKII
EWCHHHRHDDADQDYRLIPVWDAQFLNDNNGIVFLLIEAAYRLEIRGLLDIACRAVSITL
GRSMNEVKVMLRVGEPEDVFNVDDELREDDEEDADMIPAIPAA
Download sequence
Identical sequences E3MJM9
CRE19166 XP_003103612.1.11157 31234.CRE19166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]