SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19167
Domain Number 1 Region: 9-75
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000981
Family BTB/POZ domain 0.0017
Further Details:      
 
Domain Number 2 Region: 85-132
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0000000000732
Family Skp1 dimerisation domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19167
Sequence length 150
Comment (Caenorhabditis remanei)
Sequence
MQVEQPVALYKLRSSEPQIFLVDRRTVAMIGRLEELFTTVGLDRIPSDQLPPIVLELPAT
VLRKLIEWCDHHKFDAPFDESQPLPAELPDWDTNFFMIRHTLLFDLLRAARHFDVPGLFS
MCCHVVQQNPLEIMGGLFNDVPQERSAAAA
Download sequence
Identical sequences E3MJN0
CRE19167 31234.CRE19167 XP_003103689.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]