SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19204 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19204
Domain Number 1 Region: 34-145
Classification Level Classification E-value
Superfamily POZ domain 1.28e-19
Family Tetramerization domain of potassium channels 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19204
Sequence length 177
Comment (Caenorhabditis remanei)
Sequence
MLARASLHSNGADMHTAEYAEYKKEEITAHHARDLVHINAGGTRFTTLYDTLAQSKSSYF
LNFIRIDRTTGKVVLLQQRTIRDESGAIFVNRDGRLFAFVLQFMRDGKNTVLPKDKDLLA
QLRREADFFGMEVFKYLIQETLVDLEKEQRASTIDIADIRNSVNQIANNTYYTGGRN
Download sequence
Identical sequences E3MJE4
CRE19204 31234.CRE19204 XP_003103581.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]