SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19334
Domain Number 1 Region: 43-143
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.84e-18
Family HSP20 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19334
Sequence length 154
Comment (Caenorhabditis remanei)
Sequence
MSLYHYYRPTQHSLFNELMRDFTRVDRLNKNFSEVSSQNFLLFLNSGLFQITNTDEKFAI
NLNVSQFKPENLKINLEGRTLTIQGDEEIKNEHGYSKKSFSRVILLPEDVDVSAVASKLS
EDGKLAIEAPKKEVVQGRSIEIQRKEALEEKAQE
Download sequence
Identical sequences E3N520
CRE19334 XP_003096516.1.11157 31234.CRE19334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]