SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19589
Domain Number 1 Region: 516-841
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.1e-80
Family Ankyrin repeat 0.00000757
Further Details:      
 
Domain Number 2 Region: 1094-1173
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19589
Sequence length 1817
Comment (Caenorhabditis remanei)
Sequence
MLMMLNGVLPKRKGSKQPGMHDLLIQHTRLTCSLICSSFNNKWSPMKLIKSADKDTPNLN
KVLEGLQIGYGFTAEGKINFPPPPCRVDMDKLYNGELVPNIKLWAELVAHGWMEMERKVG
RPVEMSSFQICSEGHSTNAAAAVSAVAAAATGMDSQAYLASVFAKMNNGEEMPRVPATVG
SLNAASAAMTGISFHSDDAMRLFGGASFATKMVSDNKKTCNHQQFATVHHIQEAAFRAAL
LKMDAMYKERKGAAISVVDMESNFPIDAKETRISAKSPPVGPKTTSMTVPKPEKNSAEVE
VTTEQPGVDMSFQKDGMEPSQVYPKILKLAIEMEQMYRSNPTDKAREIAVTTAYIASTLP
EQICLEMNVESGDRLLKKLLSGMSEKQKLAMMTRARKTITTETDNELLRRSADSLSDKRL
KEEYLKIFRETADCAFYDKCVREKKLKAAEQKHARTSTANVGSQNSMAPAKSQAGKVVAS
QQQSGQLRRTHSEGDGAERAKARSNAIDKSTDTTLETPLTIACANGHRDIVELLLKEGAN
IEHRDKKGFSPLIIAATAGHASVVEVLLKNHAAIEAQSDRTKDTALSLACSGGRKDVVEL
LLSHGANKEHRNVSDYTPLSLASSGGYIDIVNMLLSSGSEINSRTGSKLGISPLMLASMN
GHKEATKVLLEKGSDINAQIETNRNTALTLASFQGRTEVVKLLLQYHANVEHRAKTGLTP
LMECATGGYVEVGTLLIEAGADPNASPVQATKDTALTIAAEKGNDKFVEMLLDHDAAIDA
RNKKGCSALWLACNNGHLSTAEVLITKGADPDTFDNRKISPMMAAFRKGHIEMVTFMVGH
AKQFPNETDLSRAVQAIESEDTKAKCNSCIDVIRNAKKAQAESAEKAANSLLEQIDEENA
KNEEKKQKQKEKKNKKKEAKKKEKVEGASQQPEPEPEPAEENVEEPEPAPAPEPEPEPEP
ENVPVPEPTPAVVEEPPKDPPKPRRNRRKTNPDGVPKGPKVVKEVKPIVEEEPSELPYAP
IKVTIPPPAQVQAPMVSPSSYSESEEWCKAGKEGKKARPAKRPDGRQTAPSSGGSSQPKN
ASATSSVASERQNPWEVDTKGSKVFEFTVLGNIVSRVIGKSGSNINAVREATGAQIEIDK
LGGSKEDDRHITVRGSADTVSHATNIIYLLIHDKNMLITDAIRTVLRGNLSVASSLSSEG
TSRSAVDSTSYAPSSIPQSMSSASLARQSSSPAPVSTQPQAHPKPSKSHGHQTSKDHSGG
SSGGGNVWQQRMAARQEKEPAPISQSPKPTVPSPQQVRQQTPPQPIRQQSVPVQTATVPT
PLKATTPTPARATTPLDRVIAPPVRRETPVAAASVQPVQQVHVAQPRQEPVSAQQQQRLP
EPVQRHPEPSGQAQRYPEPISRPQSSAHPMQQVQQQQPTFSKAPGTRVSTDFSRAPGPPT
QAASNVPQTKAEVFDDRLAFGQFKQTAPGPPGTPNAQSASSLNTSLNDPSNGSIDFDISK
LRMFDDGKTGGNIWGKGGEDSDTWGGLFTQFFPTSSTASVSSPLSSTVPTPMRSETRNDT
EWPQSDAFNQLLSEQSQMSSNLGASTSSRQQQVTPGMSSLESKGWMPSSFTPSARDPNRT
QPPLFARSPSSSAAATNPSTLLQQQQQQQQRYQQQIHEQQQQQQQALQQQRMFQQQFSQT
QSTLQQQQQQMYQLRMNPAYGQLAQQLLDHEKTSAPGPSHQPPSSSQLANSYYPSPSYTD
NSVLGQLNLATMAQRGIKQFDGFNNDQPVNDSILAAIIEQKKNHSASVAKSRPNSSPPQV
WEKAATSLGQTLRLSPH
Download sequence
Identical sequences E3NRG1
XP_003089010.1.11157 CRE19589 31234.CRE19589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]