SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19774 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19774
Domain Number 1 Region: 8-112
Classification Level Classification E-value
Superfamily POZ domain 1.8e-18
Family BTB/POZ domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19774
Sequence length 176
Comment (Caenorhabditis remanei)
Sequence
MSATPKMSIYESTFAQSDKTDAILVVEGKKLHVNKSLLSCHSTYFKTMFNSAPGSSEFQI
DNVSLEEFATLLSQFQLNPIKPTRRNVENVLKLADRFALPAAKRYVELYLMTSYEFNFGF
DETIRIAKEHELYCLLERTICWEPPKFIEFIYSGHFKTLPDKVQAKILHSCLDRYK
Download sequence
Identical sequences E3MT95
CRE19774 31234.CRE19774 XP_003100619.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]