SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE19775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE19775
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily POZ domain 7.85e-21
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE19775
Sequence length 172
Comment (Caenorhabditis remanei)
Sequence
MESLFEPSDMTDAILVVEGKKLHVNKALLSYHSDYFKNLFSGNTRKKEFPIGGVTYTLFS
TLLSFVHSKPIVPDESSIYSLLMLADQFLIPAAKRHIELILISSIPRNEKLAQYAFQYRL
NELTEIMLKQFYQQRDHKVFTNVRRSDWFKKLPDKDQVEVMLMYLKIVRARA
Download sequence
Identical sequences E3MT96
31234.CRE19775 XP_003100542.1.11157 CRE19775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]